PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf02232g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family HD-ZIP
Protein Properties Length: 238aa    MW: 27201.9 Da    PI: 8.3605
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf02232g00005.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.61e-1875129256
                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               rk+ ++tkeq  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  Peinf101Scf02232g00005.1  75 RKKLRLTKEQSIILEESFKEHSTLNPKQKLTLAKRLGLRPRQVEVWFQNRRARTK 129
                               678899***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046184.2E-14243IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.607.8E-1859125IPR009057Homeodomain-like
SuperFamilySSF466899.41E-1966132IPR009057Homeodomain-like
PROSITE profilePS5007117.08671131IPR001356Homeobox domain
SMARTSM003891.1E-1573135IPR001356Homeobox domain
PfamPF000463.2E-1675129IPR001356Homeobox domain
CDDcd000864.59E-1575132No hitNo description
PRINTSPR000312.3E-5102111IPR000047Helix-turn-helix motif
PROSITE patternPS000270106129IPR017970Homeobox, conserved site
PRINTSPR000312.3E-5111127IPR000047Helix-turn-helix motif
SMARTSM003402.3E-24131174IPR003106Leucine zipper, homeobox-associated
PfamPF021837.9E-11131165IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
METRSFLKGI DVNRVADTEE EAGVSSPNST ISTVSGNKRN EREANYCEDN MIEMERACSR  60
GGIINSDEED GETCRKKLRL TKEQSIILEE SFKEHSTLNP KQKLTLAKRL GLRPRQVEVW  120
FQNRRARTKL KQTEVDYEFL KRCVENLTEE NRRLQKEVQE LRGLKRSPQF YMQMTPPTTL  180
TMCPSCELVA SGPTNTPVNI GPQQLGPSQQ QPMPFNLWAT TPIPQGPLDS YPLLGRQK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123131RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015077450.11e-127PREDICTED: homeobox-leucine zipper protein HAT4
SwissprotP466021e-83HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A0V0HY501e-127A0A0V0HY50_SOLCH; Putative homeobox-leucine zipper protein HAT4-like
STRINGSolyc06g060830.2.11e-126(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.14e-84homeobox-leucine zipper protein 3